DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and GPT2

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_012993.3 Gene:GPT2 / 853941 SGDID:S000001775 Length:743 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:40/183 - (21%)
Similarity:63/183 - (34%) Gaps:48/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 FSYPDPVWL------LLNAEGTRFTPAKHELSVKFA---EERGLPLL----KHH--------LIP 203
            |.|....||      |.|   ..||....|:.|:.|   .|.|:|.:    .|.        ::.
Yeast    31 FVYNIHTWLYDVSVFLFN---ILFTIFFREIKVRGAYNVPEVGVPTILVCAPHANQFIDPALVMS 92

  Fly   204 RTKGFTTSLPTMRGICPAIYDINLAFKK----------NAEPKPTMLSQLNGEPVEPYMYIRRVP 258
            :|:...||....|...|.......:|||          ...|.|.:  |.|.:||:..:.|....
Yeast    93 QTRLLKTSAGKSRSRMPCFVTAESSFKKRFISFFGHAMGGIPVPRI--QDNLKPVDENLEIYAPD 155

  Fly   259 L----DVVPDDEKEAAAWMQDF---FAEKDKIIDSFHETGSFFKNSGVKEVPE 304
            |    :::....|.......:|   |:.|     |......:..|:.:||:|:
Yeast   156 LKNHPEIIKGRSKNPQTTPVNFTKRFSAK-----SLLGLPDYLSNAQIKEIPD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 40/183 (22%)
LPLAT_LCLAT1-like 58..255 CDD:153252 29/125 (23%)
Acyltransf_C 243..320 CDD:292694 14/69 (20%)
GPT2NP_012993.3 LPLAT 45..348 CDD:418432 36/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.