DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and SLC1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_010231.1 Gene:SLC1 / 851508 SGDID:S000002210 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:72/302 - (23%)
Similarity:119/302 - (39%) Gaps:83/302 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LGRLLIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRV 71
            |..:|:.:....|||:..|..:|..|:.:.             |.:.:....|   :|...||.:
Yeast    11 LRSVLVVLALAGCGFYGVIASILCTLIGKQ-------------HLAQWITARC---FYHVMKLML 59

  Fly    72 YIDPQDEQKFFGKEH-----GLLLMNHTYEIDWLTAWMITDKLGNL--GGTKAYAKKMLRYVPVL 129
            .:|    .|..|:|:     .:::.||...:|..       .||.:  .|....|||.|:|||.|
Yeast    60 GLD----VKVVGEENLAKKPYIMIANHQSTLDIF-------MLGRIFPPGCTVTAKKSLKYVPFL 113

  Fly   130 GWVWWMAEFIFLDRNFEKDKV-VIKTQLKEVFSYPDPVWLLLNAEGTR-FTPAKHELSVKFAEER 192
            ||...::...||||:..::.: .:...|:.|......:|:.  .|||| :|   .||::      
Yeast   114 GWFMALSGTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVF--PEGTRSYT---SELTM------ 167

  Fly   193 GLPLLK--HHLIPRTKGFTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPYMYIR 255
             ||..|  .||..:.|     :|    |.|.:          .....|::|...|......|.:|
Yeast   168 -LPFKKGAFHLAQQGK-----IP----IVPVV----------VSNTSTLVSPKYGVFNRGCMIVR 212

  Fly   256 RV-PL---DVVPDDEKEAAAWMQDFFAEK--DKIIDSFHETG 291
            .: |:   ::..|...|        ||||  |:::|:..|.|
Yeast   213 ILKPISTENLTKDKIGE--------FAEKVRDQMVDTLKEIG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 70/297 (24%)
LPLAT_LCLAT1-like 58..255 CDD:153252 51/207 (25%)
Acyltransf_C 243..320 CDD:292694 14/55 (25%)
SLC1NP_010231.1 AGP_acyltrn 60..191 CDD:129621 43/172 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.