DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and LPAT5

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001030724.2 Gene:LPAT5 / 821418 AraportID:AT3G18850 Length:375 Species:Arabidopsis thaliana


Alignment Length:393 Identity:114/393 - (29%)
Similarity:184/393 - (46%) Gaps:67/393 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRGLGRLLIAVT--FFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYA- 65
            |||:..|::.|:  |....|:..:..::|.|              :.:.||..|:......|.| 
plant    18 LRGIICLMVLVSTAFMMLIFWGFLSAVVLRL--------------FSIRYSRKCVSFFFGSWLAL 68

  Fly    66 -------GSKLRVYIDPQDEQKFFG-----KEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAY 118
                   .:|.:|.        |.|     ::..||:.||..|:||:..|.:..:.|.:|..|..
plant    69 WPFLFEKINKTKVI--------FSGDKVPCEDRVLLIANHRTEVDWMYFWDLALRKGQIGNIKYV 125

  Fly   119 AKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYP-DPVWLLLNAEGTRFTPAKH 182
            .|..|..:|:.||.:.:.|||.::|.:|.|:..:: |:...|..| |.:||.|..|||.:|.||.
plant   126 LKSSLMKLPLFGWAFHLFEFIPVERRWEVDEANLR-QIVSSFKDPRDALWLALFPEGTDYTEAKC 189

  Fly   183 ELSVKFAEERGLPLLKHHLIPRTKGFTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNG-E 246
            :.|.|||.|.|||:|.:.|:||||||.:.|..:.....|:||:.:.:|...   |:.|..:.| |
plant   190 QRSKKFAAENGLPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYKTRC---PSFLDNVYGIE 251

  Fly   247 PVEPYMYIRRVPLDVVPDDEKEAAAWMQDFFAEKDKIIDSFHETGSFFKNSGVKEVPEKIYKPRL 311
            |.|.:::|||:.|..:|:.||:..||:.:.|..||::::.|:..|.|......||...|.|    
plant   252 PSEVHIHIRRINLTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHFPNEGTEKEFNTKKY---- 312

  Fly   312 STLLNFLGWATFAVLCILHYLVTSLVAGNWFGFITVLSILGGFY------------SLMEYAVNA 364
              |:|.|....|..:|......:|::   ||.....|:.:   |            .|:|.|.|:
plant   313 --LINCLAVIAFTTICTHLTFFSSMI---WFRIYVSLACV---YLTSATHFNLRSVPLVETAKNS 369

  Fly   365 SKI 367
            .|:
plant   370 LKL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 109/382 (29%)
LPLAT_LCLAT1-like 58..255 CDD:153252 68/211 (32%)
Acyltransf_C 243..320 CDD:292694 26/77 (34%)
LPAT5NP_001030724.2 PLN02510 1..375 CDD:178126 114/393 (29%)
LPLAT_LCLAT1-like 70..260 CDD:153252 66/201 (33%)
Acyltransf_C 251..315 CDD:292694 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2059
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 1 1.000 - - FOG0001449
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.