DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and LPCAT1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_011512434.1 Gene:LPCAT1 / 79888 HGNCID:25718 Length:571 Species:Homo sapiens


Alignment Length:117 Identity:25/117 - (21%)
Similarity:46/117 - (39%) Gaps:17/117 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 WYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKMLRYVP 127
            |:||...||.:  :..|....:...|.|..|:...|.:...|....:        ..|...|.:|
Human   144 WFAGGFHRVAV--KGRQALPTEAAILTLAPHSSYFDAIPVTMTMSSI--------VMKAESRDIP 198

  Fly   128 VLGWVWWMAEFIFLDRNFE--KDKVV--IKTQLKEVFSYPDPVWLLLNAEGT 175
            :.|.:......:|:.|:.:  :.|.|  ||.:.:....:|.   :::..|||
Human   199 IWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQ---IMIFPEGT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 25/117 (21%)
LPLAT_LCLAT1-like 58..255 CDD:153252 25/117 (21%)
Acyltransf_C 243..320 CDD:292694
LPCAT1XP_011512434.1 PlsC 95..>279 CDD:223282 25/117 (21%)
LPLAT_LPCAT1-like 140..351 CDD:153253 25/117 (21%)
EF-hand_7 458..516 CDD:290234
EF-hand_8 469..520 CDD:290545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.