DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and agpat2

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001071200.1 Gene:agpat2 / 777624 ZFINID:ZDB-GENE-061103-541 Length:271 Species:Danio rerio


Alignment Length:285 Identity:62/285 - (21%)
Similarity:107/285 - (37%) Gaps:66/285 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLLILLVRPFDKKLSRSLAYYLHYSFY----------CILVCVAEWYAGSK----LRVYIDPQDE 78
            :|.:|||.|.....|.:..:|....||          .|.:|:.:  :|.:    :||.......
Zfish     6 MLPVLLVLPLLLWTSSTFVFYFKKCFYVAYMMLLAVIAIPICILK--SGGRDIENMRVIRFLVRH 68

  Fly    79 QKFF--------GKEH------GLLLMNHTYEIDWL-TAWMITDKLGNLGGTKAYAKKMLRYVPV 128
            .|:|        |.||      .:::.||...:|.| ...::.|:...:      |||.|.:...
Zfish    69 VKYFLGLRYQVSGWEHLQTEGPYVIISNHQSSLDVLGMVEILPDRCTMI------AKKELIWAGT 127

  Fly   129 LGWVWWMAEFIFLDRNFEKD-KVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAEER 192
            :|.:.|:...:|::|....| |.|:....|.:.:  |.:.|.:..||||             .:.
Zfish   128 VGMICWLGGIVFINRKKTSDAKNVMSDAAKTMLT--DKIRLWVFPEGTR-------------NQN 177

  Fly   193 GLPLLKHHLIPRTKG-FTTSLPTMRGICPAIYDINLAF--KKNAEPKPTMLSQLNGEPVEPYMYI 254
            |      .|:|..|| |..::.....|.|.::.....|  :|..|.|...::.    .|.|.:..
Zfish   178 G------GLLPFKKGAFHLAIQAQVPIIPIVFSSYSKFYLRKEKEFKSGTITL----KVLPKIET 232

  Fly   255 RRVPLDVVPDDEKEAAAWMQDFFAE 279
            :.:..|.|.....:|...|:..|.|
Zfish   233 KGLTADDVTTLSDQAFGVMRSAFME 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 62/285 (22%)
LPLAT_LCLAT1-like 58..255 CDD:153252 46/219 (21%)
Acyltransf_C 243..320 CDD:292694 8/37 (22%)
agpat2NP_001071200.1 PlsC 31..265 CDD:223282 55/260 (21%)
LPLAT_AGPAT-like 66..246 CDD:153251 44/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.