DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and Tmem68

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_082373.1 Gene:Tmem68 / 72098 MGIID:1919348 Length:329 Species:Mus musculus


Alignment Length:288 Identity:52/288 - (18%)
Similarity:91/288 - (31%) Gaps:99/288 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GRLLIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCIL-----VCVAEWYAGS 67
            |.:.|...:|....|:..|:...::.    |..:.:...:.|....:|.|     .||....:|.
Mouse   130 GAIPIDFYYFMAKIFIQKGRTCRVVA----DHFVFKIPGFSLLLDVFCALHGPREKCVEILRSGH 190

  Fly    68 KLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKML-RYVPVLGW 131
            .|.  |.|       |.....||.:.||.|.|             |..|.:|:..: ..||::  
Mouse   191 LLA--ISP-------GGVREALLSDETYNIIW-------------GNRKGFAQVAIDAKVPII-- 231

  Fly   132 VWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAEERGLPL 196
                              .:....::|.|.         :..|||.....:|   ||        
Mouse   232 ------------------PMFTQNIREGFR---------SLGGTRLFKWLYE---KF-------- 258

  Fly   197 LKHHLIPRTKGFTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPYMYIRRVPLDV 261
             ::...|...||...|.|..| .|..||..:..::.||.....:..|    ::.:   :|:|.::
Mouse   259 -RYPFAPMYGGFPVKLRTFLG-DPIPYDPKVTAEELAEKTKNAVQAL----IDKH---QRIPGNI 314

  Fly   262 VPDDEKEAAAWMQDFFAEKDKIIDSFHE 289
                              :..::|.||:
Mouse   315 ------------------RSALLDRFHK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 51/284 (18%)
LPLAT_LCLAT1-like 58..255 CDD:153252 38/197 (19%)
Acyltransf_C 243..320 CDD:292694 6/47 (13%)
Tmem68NP_082373.1 PlsC 58..303 CDD:223282 46/240 (19%)
LPLAT_MGAT-like 103..309 CDD:153249 47/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.