DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and Aup1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001073368.1 Gene:Aup1 / 680423 RGDID:1591777 Length:410 Species:Rattus norvegicus


Alignment Length:163 Identity:36/163 - (22%)
Similarity:53/163 - (32%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRVY-----------IDPQDEQKF 81
            ||.:||..|....|   |...|....:..||..|  ...|.||.:           :..|::...
  Rat    25 LLALLLYAPVGLCL---LVLRLFLGLHVFLVSCA--LPDSVLRRFVVRTMCAVLGLVARQEDSGL 84

  Fly    82 FGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFE 146
            ......:|:.||....|.....::|          ..:..:|...|  .:|.|...|:.:||..|
  Rat    85 RDHRVRVLISNHVTPFDHNIVNLLT----------TCSTPLLNSPP--SFVCWSRGFMEMDRRVE 137

  Fly   147 ----KDKVVIKTQLKEVFSYPDPVWLLLNAEGT 175
                ..|....|:|.     |.|:.|....|.|
  Rat   138 LVESLKKFCASTRLP-----PTPLLLFPEEEAT 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 36/163 (22%)
LPLAT_LCLAT1-like 58..255 CDD:153252 27/133 (20%)
Acyltransf_C 243..320 CDD:292694
Aup1NP_001073368.1 LPLAT 66..264 CDD:302626 22/117 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..293
CUE_AUP1 300..340 CDD:270603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.