DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and gpat4

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001035339.2 Gene:gpat4 / 678522 ZFINID:ZDB-GENE-060421-5102 Length:451 Species:Danio rerio


Alignment Length:191 Identity:43/191 - (22%)
Similarity:82/191 - (42%) Gaps:42/191 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHLRGLGRLL-------IAVTFFTCGFFVNIGQLLLIL--LVRPF-DKKLSRSLAYYLHYSFYC 55
            ::.|.|:|.|:       :.||.    .|..:| ||::|  :|..| :.::...|:..:|  ..|
Zfish   155 LTALWGVGVLIRYGFLLPLRVTL----AFTGVG-LLVVLTSIVGLFPNGRMKNYLSDKVH--LMC 212

  Fly    56 ILVCVAEWYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTA------WMITDKLGNLGG 114
            ..:||.   |.:.:..|.|.:::.    |..|:.:.|||..||.:..      .|:....|.|.|
Zfish   213 YRICVR---ALTAIITYHDSENKP----KNGGICVANHTSPIDVIILASDGCYAMVGQVHGGLMG 270

  Fly   115 TKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGT 175
              ...:.|::..|          .|:.:|:..||:.::..:|.:..:....:.:|:..|||
Zfish   271 --VIQRAMVKACP----------HIWFERSEVKDRHLVAKRLSDHVADESKLPILIFPEGT 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 39/173 (23%)
LPLAT_LCLAT1-like 58..255 CDD:153252 27/124 (22%)
Acyltransf_C 243..320 CDD:292694
gpat4NP_001035339.2 LPLAT_LPCAT1-like 213..422 CDD:153253 27/126 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.