DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Agpat4 and lpcat2

DIOPT Version :9

Sequence 1:	NP_001261942.1	Gene:	Agpat4 / 39819	FlyBaseID:	FBgn0036622	Length:	380	Species:	Drosophila melanogaster
Sequence 2:	NP_001018492.1	Gene:	lpcat2 / 553683	ZFINID:	ZDB-GENE-050522-229	Length:	529	Species:	Danio rerio

Alignment Length:	78	Identity:	20/78 - (25%)
Similarity:	28/78 - (35%)	Gaps:	14/78 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 LGRLLIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRV 71
            |||:.    ||..||.|.:.......|..|.       ||...|.||:..:.|:......:..|:
Zfish    96 LGRMY----FFGMGFKVVVKGKKASTLEAPI-------LAVAPHSSFFDAIACIESGLPSTVSRI 149

  Fly    72 YIDPQDEQKFFGK 84
               ...|...||:
Zfish   150 ---ESLEAPIFGR 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Agpat4	NP_001261942.1	PLN02380	12..366	CDD:178006	17/73 (23%)
		LPLAT_LCLAT1-like	58..255	CDD:153252	5/27 (19%)
		Acyltransf_C	243..320	CDD:292694
lpcat2	NP_001018492.1	PlsC	49..297	CDD:223282	20/78 (26%)
		LPLAT_LPCAT1-like	98..309	CDD:153253	18/76 (24%)
		HXXXXD motif. /evidence=ECO:0000250\|UniProtKB:Q3TFD2	128..133		3/4 (75%)
		EGTC motif	202..205
		EFh	316..406	CDD:298682
		EFh	378..440	CDD:238008
		EF-hand_7	378..435	CDD:290234
		EF-hand_7	415..473	CDD:290234
		EFh	418..473	CDD:238008
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0204
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900