DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and AUP1

DIOPT Version :10

Sequence 1:NP_648887.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_853553.1 Gene:AUP1 / 550 HGNCID:891 Length:410 Species:Homo sapiens


Alignment Length:96 Identity:25/96 - (26%)
Similarity:36/96 - (37%) Gaps:28/96 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LNAEGTRFTPAKHELSVKFAEERGLPLLKHHLIPRTKGFTTSLPTMRGICPAIYDINLAFKKNAE 234
            |...|||.|||.....:|         .:.|...|.:...:|.|...|..|   |:.||      
Human   252 LGQTGTRLTPADKAEHMK---------RQRHPRLRPQSAQSSFPPSPGPSP---DVQLA------ 298

  Fly   235 PKPTMLSQLNGEPVEPYMYIRRVPLDVVPDD 265
               |:..::  :.|.|:     |||.|:..|
Human   299 ---TLAQRV--KEVLPH-----VPLGVIQRD 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_648887.1 PLN02380 12..366 CDD:178006 25/96 (26%)
AUP1NP_853553.1 LPLAT 66..264 CDD:473073 7/11 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..295 13/51 (25%)
CUE_AUP1 296..340 CDD:270603 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..369
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.