DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and Lclat1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_038969005.1 Gene:Lclat1 / 362702 RGDID:1565906 Length:376 Species:Rattus norvegicus


Alignment Length:374 Identity:98/374 - (26%)
Similarity:171/374 - (45%) Gaps:36/374 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYS------FYCILVCVAEWYAGSKL 69
            |.|.:||  |....:|.:|.::.:         :|::|...|      :..:.|.:.|...|.|:
  Rat    13 LFAGSFF--GSIFMLGPILPLMFI---------NLSWYRWISSRLVAMWLTLPVALLETMFGVKV 66

  Fly    70 RVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKMLRYVPVLGWVWW 134
            .:..|     .|...|..:::|||...:||:..|....:...|...|...|..|:.||..||...
  Rat    67 VITGD-----AFVPGERSVIIMNHRTRVDWMFLWNCLMRYSYLRLEKICLKSSLKSVPGFGWAMQ 126

  Fly   135 MAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAEERGLPLLKH 199
            :|.|||:.|.::.||...:..:....:..:|:.||:..|||..|......|..|||:.||...::
  Rat   127 VAAFIFIHRKWKDDKSHFEDMVDYFCAIHEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEY 191

  Fly   200 HLIPRTKGFTTSLPTM--RGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPYMYIRRVPLDVV 262
            .|.|||.|||..:..:  |....|::||.:|:..|. |:......|...|.|.:.::.|.|:|.:
  Rat   192 VLHPRTTGFTFVVDRLRERRNLDAVHDITVAYPYNI-PQTEKHLLLGDFPKEIHFHVHRYPVDTL 255

  Fly   263 PDDEKEAAAWMQDFFAEKDKIIDSFHETGSFFKNSGVKEVP--EKIYKPRLSTLLNFLGWATF-A 324
            |..:::...|....:.||::.:.||::....|..:|...||  :...:..:..||:.|.||.| :
  Rat   256 PTSKEDLQLWCHKRWEEKEERLRSFYQGEKNFHFTGQSTVPPCKSELRVLVVKLLSILYWALFCS 320

  Fly   325 VLCILHYLVTSLVAGNWFGFITVLSILGGFYSLMEYAVNASKISKASAY 373
            .:|:|.||.:.:   .|:..|:::     |:.|.|......:|.:.:.|
  Rat   321 AMCLLIYLYSPV---RWYFIISIV-----FFVLQERIFGGLEIIELACY 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 95/364 (26%)
LPLAT_LCLAT1-like 58..255 CDD:153252 58/198 (29%)
Acyltransf_C 243..320 CDD:292694 19/78 (24%)
Lclat1XP_038969005.1 LPLAT_LCLAT1-like 55..248 CDD:153252 58/198 (29%)
Acyltransf_C 233..306 CDD:406475 16/72 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102498
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.