DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and Agpat2

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001162912.1 Gene:Agpat2 / 34176 FlyBaseID:FBgn0026718 Length:271 Species:Drosophila melanogaster


Alignment Length:261 Identity:57/261 - (21%)
Similarity:95/261 - (36%) Gaps:89/261 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSF----YCILVCVAEWYAG-SKLRVYIDPQDEQK 80
            ||:..|..|::.|..||.....|.....|..|:    .|.||.:.....| ..:|          
  Fly    31 FFIFFGAGLIVFLCVPFMILRPRDYRNALFPSWCFRQLCRLVGITMEVRGLENVR---------- 85

  Fly    81 FFGKEHG-LLLMNHTYEIDWLT---AWMITDKLGNLGGTKAYAKKMLRYVPVLG---WVWWMAEF 138
               |:|| :::|||...:|...   .|.:      :|.....:||.:.|:|..|   |:|..   
  Fly    86 ---KDHGAVVIMNHQSAVDLCVLAYLWPV------IGRATVVSKKEVLYIPFFGIGAWLWGT--- 138

  Fly   139 IFLDRNFEKDKVVIKTQLKEVFSYPD-PVWLLLNAEGTRFTPAKHELSVKFAEERGLPLLKHHLI 202
            :::||:.:.|.  |.:..||..:..: ...|||..||||.:                   |..|:
  Fly   139 LYIDRSRKTDS--INSLQKEAKAIQERNCKLLLFPEGTRNS-------------------KDSLL 182

  Fly   203 PRTKGFTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPYMYIRRVPLDVVPDDEK 267
            |..||                ..::|.:..:..:|.::|:        |.::         ||||
  Fly   183 PFKKG----------------SFHIALQGKSPVQPVVISK--------YSFM---------DDEK 214

  Fly   268 E 268
            :
  Fly   215 K 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 57/261 (22%)
LPLAT_LCLAT1-like 58..255 CDD:153252 41/205 (20%)
Acyltransf_C 243..320 CDD:292694 5/26 (19%)
Agpat2NP_001162912.1 LPLAT_AGPAT-like 65..248 CDD:153251 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.