DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and CG15450

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster


Alignment Length:182 Identity:38/182 - (20%)
Similarity:68/182 - (37%) Gaps:41/182 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRVYIDPQ--- 76
            |.:..|:.|..|.||      || :.:...|..::......:|..:.:|....||...:..|   
  Fly   135 TVWLLGWVVRYGLLL------PF-RTIGCWLCLFMISGVSMLLGHIPDWCFKKKLVELVLRQCFR 192

  Fly    77 -------DEQKFFGKEH----GLLLMNHTYEIDWLTA-----WMITDKL--GNLGGTKAYAKKML 123
                   ..::|...|:    |:.:.|||..:|.|..     :.:|.::  |.||..:....::.
  Fly   193 ITAACLPMIRRFHNTEYRPTKGICVCNHTSPLDVLVLMCDANYSLTGQVHTGILGVLQRALSRVS 257

  Fly   124 RYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGT 175
            .:      :|:       ||....|:..:...|:...|..|...:||..|||
  Fly   258 HH------MWF-------DRKELADREALGLVLRLHCSMKDRPPVLLFPEGT 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 38/182 (21%)
LPLAT_LCLAT1-like 58..255 CDD:153252 28/139 (20%)
Acyltransf_C 243..320 CDD:292694
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 24/119 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.