DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and lpcat4

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_991122.2 Gene:lpcat4 / 327566 ZFINID:ZDB-GENE-030131-5777 Length:508 Species:Danio rerio


Alignment Length:234 Identity:45/234 - (19%)
Similarity:80/234 - (34%) Gaps:84/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RYVPVLGWVWWMAE--FIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAE--GTRFTP----A 180
            |..||.||..|:..  .:||.|              .||.....:|:.:...  |.:..|    |
Zfish    64 RAEPVRGWRRWLFHHVMVFLSR--------------AVFFCVGFLWVRVKGRQAGLKEAPVLAVA 114

  Fly   181 KHE--LSVKFAEERGLPLLKHHLIPRTKGFTTSLPTMRGICPAIYDIN---LAFKKNAEPKPTML 240
            .|.  |.:......|||:    ::.|::  ...||    :..|:.:.|   |..:|:.|.:...:
Zfish   115 PHSSFLDMLVLSVTGLPI----VVSRSE--NAKLP----VIGALLEFNQSVLVSRKDPESRKKCV 169

  Fly   241 SQL----------------------NGEPV---EPYMYIRRVPLDVV-------PDDEK---EAA 270
            ||:                      ||..:   :|..::..||:..|       ||..:   :..
Zfish   170 SQICERVTSDGHWPQMLMFPEGTTTNGRALIKFKPGAFVAGVPVQPVLLHYCSQPDTVRWTWKGL 234

  Fly   271 AWMQDFFAEKDKIIDSFHETGSFFKNSGVKEVPEKIYKP 309
            :|:...          :|.|...:.:..|:.:|  :|.|
Zfish   235 SWLGAL----------WHTTSQIYSSITVEFLP--VYTP 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 45/234 (19%)
LPLAT_LCLAT1-like 58..255 CDD:153252 33/168 (20%)
Acyltransf_C 243..320 CDD:292694 15/102 (15%)
lpcat4NP_991122.2 PlsC 42..305 CDD:223282 45/234 (19%)
LPLAT_LPCAT1-like 85..291 CDD:153253 37/213 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.