Sequence 1: | NP_001261942.1 | Gene: | Agpat4 / 39819 | FlyBaseID: | FBgn0036622 | Length: | 380 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991122.2 | Gene: | lpcat4 / 327566 | ZFINID: | ZDB-GENE-030131-5777 | Length: | 508 | Species: | Danio rerio |
Alignment Length: | 234 | Identity: | 45/234 - (19%) |
---|---|---|---|
Similarity: | 80/234 - (34%) | Gaps: | 84/234 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 RYVPVLGWVWWMAE--FIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAE--GTRFTP----A 180
Fly 181 KHE--LSVKFAEERGLPLLKHHLIPRTKGFTTSLPTMRGICPAIYDIN---LAFKKNAEPKPTML 240
Fly 241 SQL----------------------NGEPV---EPYMYIRRVPLDVV-------PDDEK---EAA 270
Fly 271 AWMQDFFAEKDKIIDSFHETGSFFKNSGVKEVPEKIYKP 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Agpat4 | NP_001261942.1 | PLN02380 | 12..366 | CDD:178006 | 45/234 (19%) |
LPLAT_LCLAT1-like | 58..255 | CDD:153252 | 33/168 (20%) | ||
Acyltransf_C | 243..320 | CDD:292694 | 15/102 (15%) | ||
lpcat4 | NP_991122.2 | PlsC | 42..305 | CDD:223282 | 45/234 (19%) |
LPLAT_LPCAT1-like | 85..291 | CDD:153253 | 37/213 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |