DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and aup1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:XP_005173140.1 Gene:aup1 / 324654 ZFINID:ZDB-GENE-030131-3375 Length:429 Species:Danio rerio


Alignment Length:289 Identity:62/289 - (21%)
Similarity:106/289 - (36%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRVYID 74
            ||:.:.:...||.:    :||.:.:......:|.:|...:...|...::|       |.|.:::.
Zfish    22 LLLLLLYAPVGFCL----MLLRIFIGVHVFLVSCALPDSIVRRFIVRIMC-------SVLGLHVQ 75

  Fly    75 PQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKMLRYVPVLGWVWWMAEFI 139
             |:..:...|...|.:.||....|.....::|.           ....|...|| |::.|...|:
Zfish    76 -QNSPRLRDKTTRLYVCNHVTHFDHNIINLLTS-----------CNTPLLEGPV-GFLCWARGFM 127

  Fly   140 FLDRNFEKDKVVIKTQLKEVF----SYPDPVWLLLNAEGTRFTPAKHELSVKFAEE---RG-LPL 196
            .|.:.     |..:|:|.|..    |.||.:.|||                 |.||   .| ..|
Zfish   128 ELGQG-----VGSRTELTETLHRYCSSPDTLPLLL-----------------FPEEDTTNGRTGL 170

  Fly   197 LKHHLIPRTKGFTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPY--MYIRRVPL 259
            ||....|    |:.|    ..|.|....:...|...:.|:.:.|::|......|:  .::|.:|.
Zfish   171 LKFSSWP----FSVS----DSIQPVALLVKRPFIAVSTPESSWLTELLWTFFVPFTVYHVRWLPP 227

  Fly   260 DVVPDDE--KEAAAWMQDFFAEKDKIIDS 286
            ....|.|  :|.|:.:|...|.:..:|.:
Zfish   228 LSKEDGETHQEFASKVQGLLATELGVIST 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 60/287 (21%)
LPLAT_LCLAT1-like 58..255 CDD:153252 44/206 (21%)
Acyltransf_C 243..320 CDD:292694 11/48 (23%)
aup1XP_005173140.1 LPLAT 63..263 CDD:302626 53/244 (22%)
CUE_AUP1 310..354 CDD:270603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.