DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and Agpat1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster


Alignment Length:280 Identity:59/280 - (21%)
Similarity:104/280 - (37%) Gaps:65/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLILLVRPFDKKLSRSLAYYLHYSFY--------CILV-------C-------VAEWYAGSKLRV 71
            |.:||:.||..:.:....||..:..|        .||:       |       .:.|.  .::..
  Fly    13 LFLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTWC--HRVST 75

  Fly    72 YIDPQDEQKFFGKEH------GLLLMNHTYEIDWL---TAWMITDKLGNLGGTKAYAKKMLRYVP 127
            .|..:.|.:  ||||      .:::.||...:|.|   ..|.:.:|      ....||:.|.|..
  Fly    76 LIGLRWELR--GKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNK------CTVVAKRELFYAW 132

  Fly   128 VLGWVWWMAEFIFLDR-NFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGT-RFTPAKHEL---SVK 187
            ..|...|:|..||:|| ..||.:..:....:.:......:|:.  .||| |.|.|.|..   :..
  Fly   133 PFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVF--PEGTRRNTGALHPFKKGAFH 195

  Fly   188 FAEERGLPLL-------------KHHLIPRTKGFTTSLP--TMRGICPAIYDINLAFKKNAEPKP 237
            .|.::.:|:|             |..::...:...|:||  :..|:...  ||::..::......
  Fly   196 MAIDQQIPILPVVFSSYCTFLNDKKKILNSGRIVITTLPPVSTEGLTKD--DIDVLMERVRSQMI 258

  Fly   238 TMLSQLNGEPVEPYMYIRRV 257
            ......:.|.:..|..|::|
  Fly   259 ETFKVTSAEALHRYKPIKKV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 59/280 (21%)
LPLAT_LCLAT1-like 58..255 CDD:153252 47/239 (20%)
Acyltransf_C 243..320 CDD:292694 4/15 (27%)
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 43/197 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.