DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and LPCAT

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001036265.1 Gene:LPCAT / 31899 FlyBaseID:FBgn0052699 Length:533 Species:Drosophila melanogaster


Alignment Length:100 Identity:24/100 - (24%)
Similarity:40/100 - (40%) Gaps:21/100 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GGTKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKV-VIKTQLKEVFSYPDPVWLLLNAEGT- 175
            |.....||:....:|:||.:...|:.|::.|.....:. .|:..:....|..|...:::.|||| 
  Fly   171 GPPSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVVIFAEGTC 235

  Fly   176 -------RFTPAKHELSVKFAEERGLP----LLKH 199
                   :|.|.        |...|:|    |||:
  Fly   236 TNRTALIKFKPG--------AFYPGVPVQPVLLKY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 24/99 (24%)
LPLAT_LCLAT1-like 58..255 CDD:153252 24/99 (24%)
Acyltransf_C 243..320 CDD:292694
LPCATNP_001036265.1 PlsC 87..>265 CDD:223282 24/99 (24%)
LPLAT_LPCAT1-like 126..338 CDD:153253 24/99 (24%)
EF-hand_8 455..507 CDD:290545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.