DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and Gpat4

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001041314.1 Gene:Gpat4 / 290843 RGDID:1310520 Length:456 Species:Rattus norvegicus


Alignment Length:187 Identity:43/187 - (22%)
Similarity:69/187 - (36%) Gaps:40/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRGLGRLL---------IAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVC 59
            |.|||.|:         ||:.|......|....::..|....|.:.||:      |....|..:|
  Rat   163 LWGLGVLIRYCFLLPLRIALAFTGISLLVAGTTVVGYLPSGRFKEFLSK------HVHLMCYRIC 221

  Fly    60 VAEWYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTA------WMITDKLGNLGGTKAY 118
            |....|       |.....:|...:..|:.:.|||..||.:..      .|:....|.|.|  ..
  Rat   222 VRALTA-------IITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQVHGGLMG--VI 277

  Fly   119 AKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGT 175
            .:.|::..|   .||:       :|:..||:.::..:|.|.......:.:|:..|||
  Rat   278 QRAMVKACP---HVWF-------ERSEVKDRHLVAKRLTEHVQDKSKLPILIFPEGT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 38/170 (22%)
LPLAT_LCLAT1-like 58..255 CDD:153252 28/124 (23%)
Acyltransf_C 243..320 CDD:292694
Gpat4NP_001041314.1 LPLAT_LPCAT1-like 218..427 CDD:153253 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.