DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and acl-11

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_491479.2 Gene:acl-11 / 185044 WormBaseID:WBGene00017888 Length:368 Species:Caenorhabditis elegans


Alignment Length:302 Identity:80/302 - (26%)
Similarity:146/302 - (48%) Gaps:30/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRVYIDP 75
            |..|.|.:|.  :.||.:..|:     .:.:::.|...|:.|:..:.:.|.|..:|  :.:|:..
 Worm    23 LSMVPFASCA--IVIGGVSWIV-----PRHVAQQLDNMLYKSYMRLCLFVFENLSG--VEIYLHG 78

  Fly    76 QDEQ---KFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAY---AKKMLRYVPVLGWVWW 134
            .:|:   |....|:.:::.||...:||:...|:..:.|:.|..:|:   .|..:..||:.||..:
 Worm    79 TNEEVVNKTGKPENAVMISNHQSNVDWIIPVMLAARHGDQGNEQAFRVMVKNSIHLVPMFGWYIF 143

  Fly   135 MAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHEL---SVKFAEERGLPL 196
            ...:|::.|..|.....:..|||.:.....|.|||:..||||.:..|..|   |.:|.|:.|...
 Worm   144 QHGYIYVRRFGEFIGAPVLRQLKWLNESDPPYWLLIFPEGTRNSAKKKHLLESSNRFLEKSGRQP 208

  Fly   197 LKHHLIPRTKGFTTSLPTMRGICPAIYDINLAF--KKNAEPK---PTMLSQLNGEP--VEPYMYI 254
            :::.|.||:.|...:|..:..: .||||:.:.:  .:.||.:   |.|.....|..  .:.::::
 Worm   209 MQNVLCPRSGGLQLALDNLSTL-DAIYDVTVMYGQMRMAERRGLAPGMFDFCCGSQQFKQLHIHL 272

  Fly   255 RRVPLDVVPDDEKEAAAWMQDFFAEKDKIIDSFH----ETGS 292
            .|:|:|.||..:.|...|..:.|.:|::|||.|:    .|||
 Worm   273 DRIPIDEVPKAKLELRTWTIERFTKKERIIDEFYSEKPSTGS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 79/301 (26%)
LPLAT_LCLAT1-like 58..255 CDD:153252 54/212 (25%)
Acyltransf_C 243..320 CDD:292694 17/56 (30%)
acl-11NP_491479.2 LPLAT_LCLAT1-like 63..273 CDD:153252 54/212 (25%)
Acyltransf_C 266..>309 CDD:374349 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51956
OrthoDB 1 1.010 - - D959325at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3473
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.