DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and acl-1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_510606.1 Gene:acl-1 / 181671 WormBaseID:WBGene00010339 Length:262 Species:Caenorhabditis elegans


Alignment Length:295 Identity:63/295 - (21%)
Similarity:115/295 - (38%) Gaps:65/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSHLRGLGRLLIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYA 65
            ::.|..:|..:.||.|..|   :.||..|..|...||.|..:.      |:..:.|...:. |..
 Worm    16 LAQLPVIGFYIRAVYFGMC---LIIGGFLGGLASIPFGKSPNN------HFRMFKIFQAMT-WPM 70

  Fly    66 GSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWL---TAWMITDKLGNLGGTKAYAKKMLRYVP 127
            |    |..:.::.:....|:..:::.||...:|.|   .||.:        ......|..|:|:|
 Worm    71 G----VRFELRNSEILHDKKPYIIIANHQSALDVLGMSFAWPV--------DCVVMLKSSLKYLP 123

  Fly   128 VLGWVWWMAEFIFLDRNFEKDKVV--IKTQLKEVFSYPDPVWLLLNAEGTRFTPAKHELSVKFAE 190
            ......::.:.::::| |.|:|.:  :.|.|.|:.:....||:.  .||||  .|:.|       
 Worm   124 GFNLCAYLCDSVYINR-FSKEKALKTVDTTLHEIVTKKRKVWIY--PEGTR--NAEPE------- 176

  Fly   191 ERGLPLLKHHLIPRTKG-FTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPYMYI 254
                      |:|..|| |..:......|.|.::..:..|..:||.:.|     :|..:      
 Worm   177 ----------LLPFKKGAFILAKQAKIPIVPCVFSSHKFFYSHAEKRLT-----SGNCI------ 220

  Fly   255 RRVPLDVVPDDEKEAAAWMQDFFAEKDKIIDSFHE 289
                :|::|:.:......:.|..|...||:.:..|
 Worm   221 ----IDILPEVDSSKFDSIDDLSAHCRKIMQAHRE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 61/284 (21%)
LPLAT_LCLAT1-like 58..255 CDD:153252 41/202 (20%)
Acyltransf_C 243..320 CDD:292694 8/47 (17%)
acl-1NP_510606.1 PlsC 26..>199 CDD:223282 49/216 (23%)
LPLAT_AGPAT-like 65..243 CDD:153251 45/227 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.