DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat4 and AGPAT1

DIOPT Version :9

Sequence 1:NP_001261942.1 Gene:Agpat4 / 39819 FlyBaseID:FBgn0036622 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001358366.1 Gene:AGPAT1 / 10554 HGNCID:324 Length:287 Species:Homo sapiens


Alignment Length:279 Identity:50/279 - (17%)
Similarity:86/279 - (30%) Gaps:97/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLILLVRPFDKKLSRSLAYYLHYSFY----------CILVCVAEWYAGSKLRVY----------- 72
            ||:|.:.|.....|.|..|:...:||          .|.||.........:::.           
Human    20 LLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLY 84

  Fly    73 ---IDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKMLRYVPVLGWVWW 134
               ::.:....|...:..:::.||...:|.|....:..     |.....||:.|.:....|...|
Human    85 GIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLP-----GRCVPIAKRELLWAGSAGLACW 144

  Fly   135 MAEFIFLDRNFEKDKVVIKTQLKEVFSYPD-PVWLLLNAEGTRFTPAKHELSVKFAEERGLPLLK 198
            :|..||:||....|.:.:.:::.:.....| .||:.  .||||    .|..|:            
Human   145 LAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVF--PEGTR----NHNGSM------------ 191

  Fly   199 HHLIPRTKGFTTSLPTMRGICPAIYDINLAFKKNAEPKPTMLSQLNGEPVEPYMYIRRVPLDVVP 263
                         ||..||.      .:||.:......|.::|.                     
Human   192 -------------LPFKRGA------FHLAVQAQVPIVPIVMSS--------------------- 216

  Fly   264 DDEKEAAAWMQDFFAEKDK 282
                     .|||:.:|::
Human   217 ---------YQDFYCKKER 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat4NP_001261942.1 PLN02380 12..366 CDD:178006 50/279 (18%)
LPLAT_LCLAT1-like 58..255 CDD:153252 36/211 (17%)
Acyltransf_C 243..320 CDD:292694 4/40 (10%)
AGPAT1NP_001358366.1 LPLAT_AGPAT-like 73..259 CDD:153251 38/226 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.