DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment roq and LOC797048

DIOPT Version :9

Sequence 1:NP_001261940.1 Gene:roq / 39818 FlyBaseID:FBgn0036621 Length:819 Species:Drosophila melanogaster
Sequence 2:XP_005166214.1 Gene:LOC797048 / 797048 -ID:- Length:247 Species:Danio rerio


Alignment Length:79 Identity:23/79 - (29%)
Similarity:31/79 - (39%) Gaps:18/79 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QAP--SWTDFLNCPICCNEFAASQRCPVSLGCGHTICKLCLTTLYNR-------QCPF------- 52
            |||  ...:.|.|.||.|.|....|.|..|.|.|.:|..||..:...       .|||       
Zfish    13 QAPVIYTVEELECKICYNRFDTRARKPKVLSCLHRVCAKCLKKMVELDSSPSIISCPFCRHETHV 77

  Fly    53 -DQTV-IVSDIDNL 64
             |:.: ::.|..|:
Zfish    78 PDEEIWLLQDDSNI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roqNP_001261940.1 zf-RING_5 13..55 CDD:291308 17/56 (30%)
zf-CCCH 418..444 CDD:279036
LOC797048XP_005166214.1 RING 24..75 CDD:238093 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.