powered by:
Protein Alignment roq and rnf224
DIOPT Version :9
Sequence 1: | NP_001261940.1 |
Gene: | roq / 39818 |
FlyBaseID: | FBgn0036621 |
Length: | 819 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001121828.1 |
Gene: | rnf224 / 795181 |
ZFINID: | ZDB-GENE-070705-92 |
Length: | 187 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 19/47 - (40%) |
Similarity: | 25/47 - (53%) |
Gaps: | 7/47 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 LNCPICCNEFAASQRCPVSLGCGHTICKLC---LTTLYNRQ----CP 51
|:|.:|.:.:...:|.|..|.||||.|:.| |.||.|.| ||
Zfish 54 LDCIVCYSAYNLGERLPRKLYCGHTFCQACLKRLDTLINEQMWIPCP 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170592146 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.