DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment roq and rnf224

DIOPT Version :10

Sequence 1:NP_648886.1 Gene:roq / 39818 FlyBaseID:FBgn0036621 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001121828.1 Gene:rnf224 / 795181 ZFINID:ZDB-GENE-070705-92 Length:187 Species:Danio rerio


Alignment Length:47 Identity:19/47 - (40%)
Similarity:25/47 - (53%) Gaps:7/47 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LNCPICCNEFAASQRCPVSLGCGHTICKLC---LTTLYNRQ----CP 51
            |:|.:|.:.:...:|.|..|.||||.|:.|   |.||.|.|    ||
Zfish    54 LDCIVCYSAYNLGERLPRKLYCGHTFCQACLKRLDTLINEQMWIPCP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roqNP_648886.1 rad18 2..>95 CDD:273165 19/47 (40%)
mRING-HC-C3HC3D_Roquin 11..54 CDD:438300 19/47 (40%)
ROQ_II 269..324 CDD:436456
zf-CCCH 418..444 CDD:459885
rnf224NP_001121828.1 RING-HC_RNF224 54..112 CDD:438227 19/47 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.