DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment roq and NHLRC1

DIOPT Version :9

Sequence 1:	NP_001261940.1	Gene:	roq / 39818	FlyBaseID:	FBgn0036621	Length:	819	Species:	Drosophila melanogaster
Sequence 2:	NP_940988.2	Gene:	NHLRC1 / 378884	HGNCID:	21576	Length:	395	Species:	Homo sapiens

Alignment Length:	97	Identity:	28/97 - (28%)
Similarity:	42/97 - (43%)	Gaps:	11/97 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    12 LNCPICCNEFA-ASQRCPVSLGCGHTICKLCLTTLYN-----RQCPFDQTVI--VSDIDNLPINH 68
            |.|.:|..:|. ..||.|.:|.|||.:|..|:..|.:     .:|||.:...  ....|.||:.|
Human    24 LECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAHPRTLALECPFCRRACRGCDTSDCLPVLH 88

  Fly    69 ALLQLVKDSELLELAPPPPSVQKLEPEHLKCY 100
             |::|:  ...|..:|.........|..|.|:
Human    89 -LIELL--GSALRQSPAAHRAAPSAPGALTCH 117

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
roq	NP_001261940.1	zf-RING_5	13..55	CDD:291308	16/47 (34%)
roq	NP_001261940.1	zf-CCCH	418..444	CDD:279036
NHLRC1	NP_940988.2	RING-HC_malin	25..72	CDD:319430	16/46 (35%)
		RING-HC finger (C3HC4-type)	26..71	CDD:319430	15/44 (34%)
		HemN	53..>133	CDD:333012	16/68 (24%)
		NHL 1	113..157		2/5 (40%)
		NHL_TRIM32_like	118..391	CDD:271331	28/97 (29%)
		NHL repeat	129..169	CDD:271331
		NHL 2	161..204
		NHL repeat	177..216	CDD:271331
		NHL 3	205..245
		NHL repeat	218..259	CDD:271331
		NHL 4	248..300
		NHL repeat	261..313	CDD:271331
		NHL 5	301..349
		NHL repeat	321..353	CDD:271331
		NHL 6	350..393
		NHL repeat	364..390	CDD:271331
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3350
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940