powered by:
Protein Alignment roq and Rnf224
DIOPT Version :9
Sequence 1: | NP_001261940.1 |
Gene: | roq / 39818 |
FlyBaseID: | FBgn0036621 |
Length: | 819 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028582.1 |
Gene: | Rnf224 / 329360 |
MGIID: | 2685603 |
Length: | 156 |
Species: | Mus musculus |
Alignment Length: | 92 |
Identity: | 26/92 - (28%) |
Similarity: | 37/92 - (40%) |
Gaps: | 19/92 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 NCPICCNEFAASQRCPVSLGCGHTICKLCLTTL----YNR------QCPFDQTVIVSDIDNLPIN 67
:|.||.:.:..|...|..|.||||.|:.|:..| :.: ||.....|....:..|.::
Mouse 22 DCIICYSAYDLSVHLPRRLYCGHTFCQACMQRLDMPAHEQHWIPCPQCRQSTPVPRGGVTMLDLD 86
Fly 68 HALLQLVKDSELLELAPPPPSVQKLEP 94
.|....|| |...|| |:||
Mouse 87 LAAFLAVK-------AEREPS--KIEP 104
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
roq | NP_001261940.1 |
zf-RING_5 |
13..55 |
CDD:291308 |
15/51 (29%) |
zf-CCCH |
418..444 |
CDD:279036 |
|
Rnf224 | NP_001028582.1 |
RING |
22..73 |
CDD:238093 |
15/50 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167846933 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.