DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment roq and Rnf182

DIOPT Version :9

Sequence 1:NP_001261940.1 Gene:roq / 39818 FlyBaseID:FBgn0036621 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_899027.1 Gene:Rnf182 / 328234 MGIID:3045355 Length:247 Species:Mus musculus


Alignment Length:218 Identity:50/218 - (22%)
Similarity:77/218 - (35%) Gaps:79/218 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIQAPS---WTDFLNCPICCNEFAASQRCPVSLGCGHTICKLCLTTLYN--------RQCPF--D 53
            |::.|:   .:|.|.|.||.|.:...||.|..|.|.|.:|..||..:.:        ..|||  .
Mouse     5 PLEEPAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRF 69

  Fly    54 QTVIVSD-IDNLPINHALLQLVKDSELLELAPPPPSVQKLEPEHLKCYQLGQRCIEELALHLKSF 117
            :|.:..| :.:||.::.:|                       .:|.|...|::|:.|        
Mouse    70 ETCLPDDEVSSLPDDNNIL-----------------------VNLTCGGKGKKCLPE-------- 103

  Fly   118 LNLNGNGNLLTRPMLRKLV----TLVNCQLMEEEGRVRALRAARSLGERTVTELILQHQNPQQLS 178
               |....|||...|..||    |..||.:                    :|.:.:|.::...||
Mouse   104 ---NPTELLLTPKRLASLVSPSHTSSNCLV--------------------ITIMEVQRESSPSLS 145

  Fly   179 SNLWAAVRTRGCQFLGPAMQEEV 201
            |       |...:|..||..:.|
Mouse   146 S-------TPVVEFYRPASFDSV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roqNP_001261940.1 zf-RING_5 13..55 CDD:291308 16/51 (31%)
zf-CCCH 418..444 CDD:279036
Rnf182NP_899027.1 RING-HC_RNF182 19..69 CDD:319469 16/49 (33%)
RING-HC finger (C3HC4-type) 20..67 CDD:319469 15/46 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.