DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment roq and RNF227

DIOPT Version :9

Sequence 1:NP_001261940.1 Gene:roq / 39818 FlyBaseID:FBgn0036621 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001345628.1 Gene:RNF227 / 284023 HGNCID:27571 Length:190 Species:Homo sapiens


Alignment Length:222 Identity:51/222 - (22%)
Similarity:65/222 - (29%) Gaps:92/222 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQAPSWTD--FLNCPICCNEFAASQRCPVSL------GCGHTICKLCLTTLYNR----------- 48
            ::.||..:  .|:|.||...|....|.|..|      .||||||..||..|..|           
Human     5 VRVPSLPERGELDCNICYRPFNLGCRAPRRLPGTARARCGHTICTACLRELAARGDGGGAAARVV 69

  Fly    49 ------QCPFDQTVIVSDIDNLPINHALLQLVKDSEL---LELAPPPPSVQKLEPEHLKCYQLGQ 104
                  .|||.:..     ..|| ...|.::..||:|   ||           |....||.:   
Human    70 RLRRVVTCPFCRAP-----SQLP-RGGLTEMALDSDLWSRLE-----------EKARAKCER--- 114

  Fly   105 RCIEELALHLKSFLNLNGNGNLLTRPMLRKLVTLVNCQLMEEEGRVRALRAARSLGERTVTELIL 169
               :|.....|...:.:|..                    ||||........||.|         
Human   115 ---DEAGNPAKESSDADGEA--------------------EEEGESEKGAGPRSAG--------- 147

  Fly   170 QHQNPQQLSSNLWAAVRTRGCQFLGPA 196
                        |.|:|....:.||||
Human   148 ------------WRALRRLWDRVLGPA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
roqNP_001261940.1 zf-RING_5 13..55 CDD:291308 20/64 (31%)
zf-CCCH 418..444 CDD:279036
RNF227NP_001345628.1 RING_Ubox 17..>55 CDD:327409 15/37 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..145 9/59 (15%)
DUF4632 117..187 CDD:317804 16/87 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.