DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment roq and Nhlrc1

DIOPT Version :9

Sequence 1:	NP_001261940.1	Gene:	roq / 39818	FlyBaseID:	FBgn0036621	Length:	819	Species:	Drosophila melanogaster
Sequence 2:	NP_780549.1	Gene:	Nhlrc1 / 105193	MGIID:	2145264	Length:	401	Species:	Mus musculus

Alignment Length:	97	Identity:	31/97 - (31%)
Similarity:	41/97 - (42%)	Gaps:	11/97 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly    12 LNCPICCNEFAA-SQRCPVSLGCGHTICKLCLTTL-----YNRQCPFDQTV--IVSDIDNLPINH 68
            |.|.:|...|.. .||.|.:|.|||.:|..|:..|     ...:|||.:..  .....|.||:.|
Mouse    26 LECKVCFERFGHWQQRRPRNLPCGHVVCLACVAALAHPRTLGLECPFCRRACRACDTSDCLPVLH 90

  Fly    69 ALLQLVKDSELLELAPPPPSVQKLEPEHLKCY 100
             ||:|:  ...|..:|...|.....|..|.||
Mouse    91 -LLELL--GSTLHASPAALSAAPFAPGTLTCY 119

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
roq	NP_001261940.1	zf-RING_5	13..55	CDD:291308	16/47 (34%)
roq	NP_001261940.1	zf-CCCH	418..444	CDD:279036
Nhlrc1	NP_780549.1	zf-RING_5	27..75	CDD:291308	16/47 (34%)
		NHL 1	115..159		3/5 (60%)
		NHL_TRIM32_like	120..394	CDD:271331	31/97 (32%)
		NHL repeat	131..171	CDD:271331
		NHL 2	163..206
		NHL repeat	179..218	CDD:271331
		NHL 3	207..247
		NHL repeat	220..261	CDD:271331
		NHL 4	250..303
		NHL repeat	263..316	CDD:271331
		NHL 5	304..352
		NHL repeat	324..356	CDD:271331
		NHL 6	353..396
		NHL repeat	367..393	CDD:271331
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3350
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030