DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and AYR1

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_012142.3 Gene:AYR1 / 854682 SGDID:S000001386 Length:297 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:66/267 - (24%)
Similarity:99/267 - (37%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KNVVYLGGFGGIGQKCVQELLQ------------RPIKALAIFDLNANEQLLAKWKSQHPDTDVF 58
            |..|..|..||||.:..:||.:            .|:..|||               |..:..:.
Yeast    10 KIAVVTGASGGIGYEVTKELARNGYLVYACARRLEPMAQLAI---------------QFGNDSIK 59

  Fly    59 YHKLDITQKSDIDAAYKATAERF-------GHFDVVVNGSGL--------MNDRLVELTIQINLL 108
            .:||||::..:|     .|...|       |..|::.|.:|.        ..|..||...::|:.
Yeast    60 PYKLDISKPEEI-----VTFSGFLRANLPDGKLDLLYNNAGQSCTFPALDATDAAVEQCFKVNVF 119

  Fly   109 GVINSTLTALEYMDKAKGGKGGLIVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAM---ANPYFY 170
            |.||......|::.|||    |.||...|:||:......:||||:|..:..:.|.:   ..|:  
Yeast   120 GHINMCRELSEFLIKAK----GTIVFTGSLAGVVSFPFGSIYSASKAAIHQYARGLHLEMKPF-- 178

  Fly   171 AHSGVGFLTICPGFTDTGLLEDIGNK----TTFTYDTP----------MLAMFNRVKRQKAEDCA 221
               .|..:....|    |:..||.:|    .|..|:.|          .:|..|  |...|:..|
Yeast   179 ---NVRVINAITG----GVATDIADKRPLPETSIYNFPEGREAFNSRKTMAKDN--KPMPADAYA 234

  Fly   222 RNLVSAI 228
            :.||..|
Yeast   235 KQLVKDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 66/267 (25%)
adh_short 6..194 CDD:278532 53/217 (24%)
AYR1NP_012142.3 17beta-HSD-like_SDR_c 10..256 CDD:187632 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.