DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and PECR

DIOPT Version :10

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_060911.2 Gene:PECR / 55825 HGNCID:18281 Length:303 Species:Homo sapiens


Alignment Length:218 Identity:61/218 - (27%)
Similarity:100/218 - (45%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LAGKNVVYLGGFGGIGQKCVQELLQ---------RPIKAL--AIFDLNANEQLLAKWKSQHPDTD 56
            |.|:..:..||..|||:..|:|||:         |.::.|  |..:|.||   |...|...    
Human    16 LQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQAN---LPPTKQAR---- 73

  Fly    57 VFYHKLDITQKSDIDAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLG---VINSTLTAL 118
            |...:.:|..:.:::...|:|.:.||..:.:||..|   .:.:.....|:..|   |:.:.||..
Human    74 VIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGG---GQFLSPAEHISSKGWHAVLETNLTGT 135

  Fly   119 EYMDKAKGGK-----GGLIVNISSVAGLQPTAI---MAIYS-AAKTGVTTFTRAMANPYFYAHSG 174
            .||.||....     ||.||||     :.||..   :|::| ||:.||...|:::|  ..:|.||
Human   136 FYMCKAVYSSWMKEHGGSIVNI-----IVPTKAGFPLAVHSGAARAGVYNLTKSLA--LEWACSG 193

  Fly   175 VGFLTICPG--FTDTGLLEDIGN 195
            :....:.||  ::.|. :|:.|:
Human   194 IRINCVAPGVIYSQTA-VENYGS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 Rossmann-fold NAD(P)(+)-binding proteins 6..247 CDD:473865 59/215 (27%)
PECRNP_060911.2 TER_DECR_SDR_a 16..267 CDD:187627 61/218 (28%)
Microbody targeting signal 301..303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.