DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and hpgd

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001007992.1 Gene:hpgd / 493354 XenbaseID:XB-GENE-942249 Length:264 Species:Xenopus tropicalis


Alignment Length:250 Identity:91/250 - (36%)
Similarity:128/250 - (51%) Gaps:27/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GKNVVYLGGFGGIGQKCVQELLQRPIKALAIFDLN--ANEQLLAKWKSQHPDTDVFYHKLDITQK 67
            ||..:..|...|||:..|:||||:. .|||:.|.|  |.|...|....|.......:.:.|:|.:
 Frog     5 GKVALVTGAAQGIGRAMVEELLQKG-AALALVDQNRIAGELCKASLDEQFGSHRTLFIQCDVTDQ 68

  Fly    68 SDIDAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKGGLI 132
            ..:..|::.|.|.||..|::||.:|:.|::..|.||::||..||..|...||.|.|..||.||:|
 Frog    69 EQLKDAFRKTVEHFGRLDILVNNAGVNNEKDWEKTIEVNLTSVIRGTYLGLELMSKKNGGHGGVI 133

  Fly   133 VNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMANPYFYAHSGVGFLTICPGFTDTGLLEDIGNKT 197
            :||||:|||.|.|...:|||:|.||..|||::|......:.||...|:||.|.||.|||.|..:.
 Frog   134 INISSLAGLTPAAYQPVYSASKHGVIGFTRSIAALASIGNYGVRINTVCPAFVDTPLLESIEKEE 198

  Fly   198 T----FTY--------------DTPMLA--MFNRVKRQKAEDCARNLVSAIETSK 232
            .    |.|              |..::|  |.|.::    :|.:...|..|.||:
 Frog   199 NMGEFFKYKDRIKDMMKCYGVLDPTLIAKGMINLIE----DDASNGAVMKITTSR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 90/248 (36%)
adh_short 6..194 CDD:278532 78/189 (41%)
hpgdNP_001007992.1 ADH_SDR_c_like 6..254 CDD:187584 90/248 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44229
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.