DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and Pdh

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster


Alignment Length:259 Identity:101/259 - (38%)
Similarity:151/259 - (58%) Gaps:11/259 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLAGKNVVYLGGFGGIGQKCVQELLQRPIKALAIFDLNANEQLLAKWKSQHPDTDVFYHKLDIT 65
            |...|||.|..||.||||.:..::||......:||.||..|.:...|.::.||...|...|:|:.
  Fly    18 MSFRGKNAVVTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVA 82

  Fly    66 QKSDIDAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKGG 130
            .|..::|.|:..|:.||:.|:|||.:|:.||:.|:.|:.:||.|:|||||:||.||.|..|||||
  Fly    83 NKKGVEATYEEIAKTFGNIDIVVNVAGIFNDKDVQRTLLVNLGGIINSTLSALPYMGKDNGGKGG 147

  Fly   131 LIVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMANPYFYAHSGVGFLTICPGFTDTGLLEDIGN 195
            ::||:|||.||.|..|:.:|.|.|.|:..|||.:||..:|..||:.|:|:|||.|.|.:..:...
  Fly   148 IVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVCPGATMTDMFTNFTE 212

  Fly   196 KTTF------TYDTPMLAMFNRVKRQKAEDCARNLVSAIETSKNGTVLMLEMGETTEVDMPVMW 253
            |..|      ||     .:.:|:.:|.|.|.:|.:::.:|..|||.|.::|......:::...|
  Fly   213 KIIFPETSDETY-----RILDRLNKQSAADVSRCILNVLEKDKNGAVYVIEGKRVYPLEIKPQW 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 98/246 (40%)
adh_short 6..194 CDD:278532 83/187 (44%)
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 97/240 (40%)
adh_short 23..214 CDD:278532 83/190 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455197
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - mtm6395
orthoMCL 1 0.900 - - OOG6_100916
Panther 1 1.100 - - P PTHR44229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7321
SonicParanoid 1 1.000 - - X2961
1413.780

Return to query results.
Submit another query.