DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and HPGD

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_000851.2 Gene:HPGD / 3248 HGNCID:5154 Length:266 Species:Homo sapiens


Alignment Length:251 Identity:82/251 - (32%)
Similarity:124/251 - (49%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLAGKNVVYLGGFGGIGQKCVQELLQRPIK-ALAIFDLNANEQLLAKWKSQHPDTDVFYHKLDI 64
            |.:.||..:..|...|||:...:.||.:..| ||..::|.|..|..|....|.......:.:.|:
Human     1 MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDV 65

  Fly    65 TQKSDIDAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKG 129
            ..:..:...::...:.||..|::||.:|:.|::..|.|:||||:.||:.|...|:||.|..||:|
Human    66 ADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEG 130

  Fly   130 GLIVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMANPYFYAHSGVGFLTICPGFTDTGLLEDIG 194
            |:|:|:||:|||.|.|...:|.|:|.|:..|||:.|......:|||....|||||.:|.:||.|.
Human   131 GIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIE 195

  Fly   195 N--------------KTTFTY----DTPMLAMFNRVKRQKAEDCARNLVSAIETSK 232
            .              |....|    |.|::|  |.:.....:|.....:..|.|||
Human   196 KEENMGQYIEYKDHIKDMIKYYGILDPPLIA--NGLITLIEDDALNGAIMKITTSK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 80/246 (33%)
adh_short 6..194 CDD:278532 68/188 (36%)
HPGDNP_000851.2 ADH_SDR_c_like 6..254 CDD:187584 80/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151368
Domainoid 1 1.000 138 1.000 Domainoid score I4841
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4450
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40699
orthoMCL 1 0.900 - - OOG6_100916
Panther 1 1.100 - - O PTHR44229
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.