DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and Y92H12BL.5

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_740784.1 Gene:Y92H12BL.5 / 259365 WormBaseID:WBGene00022366 Length:150 Species:Caenorhabditis elegans


Alignment Length:65 Identity:12/65 - (18%)
Similarity:30/65 - (46%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKGGLIVNI 135
            :||::...|..|....::...|:..|.:.:...|:.|:.|...    |:..::.:.|:..:.:|:
 Worm    68 EAAHRELMEEAGVRATILKKIGMFQDDVRKHRTQVFLMEVSEE----LQTWEENEYGRQRIWMNV 128

  Fly   136  135
             Worm   129  128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 12/65 (18%)
adh_short 6..194 CDD:278532 12/65 (18%)
Y92H12BL.5NP_740784.1 Nudix_Hydrolase_9 25..137 CDD:240024 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.