powered by:
Protein Alignment CG4842 and Y92H12BL.5
DIOPT Version :9
Sequence 1: | NP_648885.1 |
Gene: | CG4842 / 39817 |
FlyBaseID: | FBgn0036620 |
Length: | 259 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_740784.1 |
Gene: | Y92H12BL.5 / 259365 |
WormBaseID: | WBGene00022366 |
Length: | 150 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 12/65 - (18%) |
Similarity: | 30/65 - (46%) |
Gaps: | 4/65 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 DAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKGGLIVNI 135
:||::...|..|....::...|:..|.:.:...|:.|:.|... |:..::.:.|:..:.:|:
Worm 68 EAAHRELMEEAGVRATILKKIGMFQDDVRKHRTQVFLMEVSEE----LQTWEENEYGRQRIWMNV 128
Fly 136 135
Worm 129 128
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160161920 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.