DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and R05D8.9

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_503753.1 Gene:R05D8.9 / 187609 WormBaseID:WBGene00019886 Length:281 Species:Caenorhabditis elegans


Alignment Length:212 Identity:59/212 - (27%)
Similarity:95/212 - (44%) Gaps:33/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AGKNVVYLGGFGGIGQKCVQELLQRPIKALAIFDLNA------NEQLLAKWKSQHPDTDVFYHKL 62
            :||..:..|...||| :....|..:....:.:...||      .:::|   ||..|::.|.....
 Worm     6 SGKVALVTGSSNGIG-RAAAVLFAKDGAKVTVTGRNAERLEETRQEIL---KSGVPESHVLSVAT 66

  Fly    63 DITQKSDIDAAYKATAERFGHFDVVVNGSG-LMND-----------RLVELTIQINLLGVINSTL 115
            |:..:...|....:|.::||..|::||.:| ..||           .:.:..:|||:..|:..|.
 Worm    67 DLAAEKGQDELVNSTIQKFGRLDILVNNAGAAFNDDQGRVGVDQDVSVYDKIMQINMRSVVTLTQ 131

  Fly   116 TALEYMDKAKGGKGGLIVNISSVAG---LQPTAIMAIYSAAKTGVTTFTRAMANPYFYAHSGVGF 177
            .|.|::.||||.    |||:||:||   .||..:  .|:.:|:.:..|||..|....  ..||..
 Worm   132 KAKEHLVKAKGE----IVNVSSIAGTAHAQPGVM--YYAMSKSALDQFTRCAAIDLI--QYGVRV 188

  Fly   178 LTICPGFTDTGLLEDIG 194
            .::.||...||..|.:|
 Worm   189 NSVSPGGVTTGFGEAMG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 58/210 (28%)
adh_short 6..194 CDD:278532 57/208 (27%)
R05D8.9NP_503753.1 fabG 4..266 CDD:235975 59/212 (28%)
NADB_Rossmann 5..266 CDD:304358 59/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861353 Normalized mean entropy S2756
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.