DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4842 and hsd17b14

DIOPT Version :9

Sequence 1:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_002935043.1 Gene:hsd17b14 / 100498205 XenbaseID:XB-GENE-986127 Length:276 Species:Xenopus tropicalis


Alignment Length:246 Identity:65/246 - (26%)
Similarity:108/246 - (43%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VYLGGFGGIGQKCVQELLQRPIKALAIFDLNANEQLLAKWKSQHPDTDVFYHKLDITQKSDIDAA 73
            |..||..|||:..|:|.::...:.:........:.|..:.|:..|. |..|...|:|::.||...
 Frog    18 VITGGTKGIGEAMVKEFVKSGARVVFCSKDTEAKALENEIKAAGPG-DCIYVCCDVTKEEDIKKL 81

  Fly    74 YKATAERFGHFDVVVNGS----------GLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGK 128
            .:.|...:|..|.::|.:          |...|...:| :.:||:|...:...||.::.|.:|. 
 Frog    82 IEITVMNYGQIDCLINNAGWHPPEQTIDGTSADDFRDL-LNLNLIGYFLTAKYALPHLRKTQGN- 144

  Fly   129 GGLIVNISSVAGL--QPTAIMAIYSAAKTGVTTFTRAMANPYFYAHSGVGFLTICPGFTDTGLLE 191
               |:||||:.|:  |..||.  |.|.|..||..|:|||  ...:...|...:|.||...|.|.|
 Frog   145 ---IINISSLVGIIGQKHAIP--YVATKGAVTAMTKAMA--VDESRHNVRINSISPGNIWTPLWE 202

  Fly   192 DIGNKTTFT-------YDTPMLAMFNRVKRQKAEDCARNLVSAIETSKNGT 235
            ::.:.:..:       .|..:|.     :...||:||:   :|:..:..||
 Frog   203 ELSSHSKNSEAMIQGGIDAQLLG-----RMGTAEECAK---AALYLAAEGT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 65/246 (26%)
adh_short 6..194 CDD:278532 56/196 (29%)
hsd17b14XP_002935043.1 NADB_Rossmann 6..265 CDD:389744 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053465at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.