DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr92A

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:120 Identity:36/120 - (30%)
Similarity:47/120 - (39%) Gaps:33/120 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GGLLALTSAAGLPQRP----SSGYQEQDTARAFYSYGYRDENAARAEYSSRDG-TSRGFYSYVDA 69
            |..:|...||..|..|    |.||..||        ||..:  .::::.:|.| ..:|.||.||.
  Fly    49 GPYVAPKPAAPEPYDPDPKYSFGYDIQD--------GYTGD--LKSQHETRHGDVVKGSYSVVDP 103

  Fly    70 DGKLQTVRYEANGVQGFKAEASNQPQA------------------PVDKGKAPLP 106
            ||..:||.|.|:...||.|....:|.|                  |...|.||.|
  Fly   104 DGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAHLAPVVAPAPAPVPAHYGPAPAP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 15/43 (35%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 11/35 (31%)
Chitin_bind_4 68..120 CDD:278791 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.