DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Ccp84Ac

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_649681.1 Gene:Ccp84Ac / 40823 FlyBaseID:FBgn0004781 Length:217 Species:Drosophila melanogaster


Alignment Length:180 Identity:48/180 - (26%)
Similarity:68/180 - (37%) Gaps:45/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LALTSAAGLP-----QRPSSG---------YQEQ------------DTARAFYSYGYRDENA--- 48
            ||..||..:|     |.|...         ||:|            |.....|::.|..::|   
  Fly    13 LAAVSAGLIPVEQHDQHPQLYQAHQPQHVIYQKQHEIHPHGHEVYPDDPHPKYNFAYDVQDALSG 77

  Fly    49 -ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQP----------QAPVDKG 101
             ::::..|||| ..:|.||..||||..:||:|.|:.|.||.|....:|          .|||...
  Fly    78 DSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGFNAVVHREPLAHVHHKVVAAAPVQYH 142

  Fly   102 KAPLP----VTDTEEVQQARLNHLNALREAREKALATSLREEADRRQQEQ 147
            .||..    :.......||.:....|.......|.||...|:...|:.:|
  Fly   143 HAPAAAAAVIKSYASPSQAYVAPTYAAPAYTAPAYATHQAEQPQEREHQQ 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 18/47 (38%)
Ccp84AcNP_649681.1 Chitin_bind_4 65..117 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.