DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr76Ba

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:31/53 - (58%) Gaps:3/53 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YSYGYRDENAA--RAEYSSRDGTS-RGFYSYVDADGKLQTVRYEANGVQGFKA 88
            ::||.:|....  :.::.:|||.. :|.|:..:|||:.:.|.|.|:...||:|
  Fly   102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 14/45 (31%)
Smc <107..>387 CDD:440809
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.