DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr72Ea

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:60 Identity:29/60 - (48%)
Similarity:41/60 - (68%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YSYGYRDENAARAEYSSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPV 98
            |||||.:..:::.|..:.||.::|:|||.||.||||||.|.|:. :||...|:|.|:|.|
  Fly    49 YSYGYSEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 22/42 (52%)
Smc <107..>387 CDD:440809
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 22/46 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.