DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr67B

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:194 Identity:49/194 - (25%)
Similarity:67/194 - (34%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YQEQDTARAFYSYGYRDENAARAEYSSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQ 93
            |..||....| :|||||.|..:.|.....|...|.|.||...|:.....|.|:.. ||..| .|:
  Fly    89 YHGQDGLGQF-AYGYRDWNQGKNEKRDETGKVTGSYKYVQPHGRDFVANYYADKT-GFHVE-DNR 150

  Fly    94 PQAPVDKGKAPLPVTDTEEVQQARLNHLNALREAREKALATSLREEADRRQQEQIRNNNEDQQSG 158
            |      ....||.|.|..|.:|...|.....|     ||.:.....|....|.       ||.|
  Fly   151 P------AHLKLPATKTPAVLKAEEEHFKLWGE-----LAAAAGHNPDPYAAEY-------QQEG 197

  Fly   159 EQSLTDEDAAILERVRAELSAMLADRQR----------ELNLPRNRDDREQREKQEIRQDQRKE 212
            ....|:.:  ....|..|...:....:.          :.|:|..|:..|:.|.:.:|....|:
  Fly   198 RYQPTEPE--YQPYVHEEPPYVPGPEETGEPKGFFYAFDYNVPLLRNKEERAELERLRAINNKD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 15/42 (36%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.