powered by:
Protein Alignment Cpr72Ec and Cpr66Cb
DIOPT Version :9
Sequence 1: | NP_648884.1 |
Gene: | Cpr72Ec / 39816 |
FlyBaseID: | FBgn0036619 |
Length: | 429 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648209.1 |
Gene: | Cpr66Cb / 38940 |
FlyBaseID: | FBgn0035875 |
Length: | 162 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 23/63 - (36%) |
Similarity: | 35/63 - (55%) |
Gaps: | 5/63 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 YSYGYRDENA--ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPV 98
:.||..|.:. .::::.:||| |.:|.||.|:.||.::||.|.|:...||.|.. ...|||
Fly 91 FKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNAVV--HKTAPV 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45453250 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.