DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:93 Identity:27/93 - (29%)
Similarity:39/93 - (41%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AAGLPQRPSSGYQEQDTARAFYSYGYRDE---NAARAEYSSRDGTSRGFYSYVDADGKLQTVRYE 79
            |...|..|:..|.        :|||..|.   ::.:.|.:..:|...|.||..:.||.::.|.|.
  Fly    81 AVAEPYDPNPQYS--------FSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYT 137

  Fly    80 ANGVQGFKAEASNQPQAPVDKGKAPLPV 107
            |:.|.||.|....:..|.|...|..|.|
  Fly   138 ADKVNGFNAVVEKKGVAAVAIAKPALAV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 14/45 (31%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.