DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr62Bb

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_647667.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster


Alignment Length:89 Identity:29/89 - (32%)
Similarity:47/89 - (52%) Gaps:8/89 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CFTWTILGGLLALTSAAGLPQRPSSGYQEQDTARAFYSYGYRDENA--ARAEYSSRDG-TSRGFY 64
            ||  .||.  |||.::..: .||.......|..:..::||..|.:.  .::::.:||| ..:|.|
  Fly     6 CF--VILS--LALFASVAV-ARPGYALDYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQY 65

  Fly    65 SYVDADGKLQTVRYEANGVQGFKA 88
            |.|:.||.::||.|.|:.:.||.|
  Fly    66 SLVEPDGSIRTVDYTADSIHGFNA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 16/45 (36%)
Smc <107..>387 CDD:440809
Cpr62BbNP_647667.1 Chitin_bind_4 35..87 CDD:459790 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.