DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr56F

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:66 Identity:21/66 - (31%)
Similarity:31/66 - (46%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGYQEQD-----TARAFYSYGYRDENAAR--AEYSSRDG-TSRGFYSYVDADGKLQTVRYEA--N 81
            :||.::|     .|:..:.|..:|..:..  ....|||| .:.|.|..:..||:.|.|.|||  |
  Fly   113 NGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQN 177

  Fly    82 G 82
            |
  Fly   178 G 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 15/47 (32%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.