DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr50Cb

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:87 Identity:24/87 - (27%)
Similarity:37/87 - (42%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LPQRPSSGYQEQDTARAFYSYGYRDENAAR--AEYSSRDG-TSRGFYSYVDADGKLQTVRYEANG 82
            :|.:|...:.........:.|..:|...|.  |..:|.|| ...|.|.....||:.|.|||.|:.
  Fly    74 IPGQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADW 138

  Fly    83 VQGFKAEASNQPQAPVDKGKAP 104
            ..|:.|:.|.:.:|...:|..|
  Fly   139 KTGYHADVSYEGEATYPQGPQP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 16/45 (36%)
Smc <107..>387 CDD:440809
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.