DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr50Ca

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:313 Identity:65/313 - (20%)
Similarity:111/313 - (35%) Gaps:59/313 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGGLLALTSAAGLPQR-PS----SGYQEQDTARAFYSYGYRDENAARAEYSSRDGTSRGFYSYV 67
            |:..:::|..||...|| ||    |.|  :|..|.|....:|  :..:.:..:.|.....|..| 
  Fly    17 IMTAIISLVQAADTWQRLPSLETFSSY--EDMQRYFDQRNFR--SMRQIDNPTGDTYLAAFNQY- 76

  Fly    68 DADGKLQTVRYEANGVQGFKAEASNQPQAP----VDKGKAPLPVTDTEEVQQARLNHLNALRE-- 126
            :...:.|:.|..|......|.|....|.||    .:...|..|..:.:::  .|..|..||:|  
  Fly    77 NEQVENQSPRRVAQTHSRIKREQRQLPTAPRMLRFELADAVEPSPELKQI--LRQYHARALKENP 139

  Fly   127 --------------AREKALATSLREEADRRQQEQIRNNNEDQQSGEQSLTDEDAAILERVRAEL 177
                          |.....||..:....|||:..:....:......|.:..|:..  .|....:
  Fly   140 TAASPASTSQAPTPAVSPTKATKAKSRKPRRQRRSVVGAQQPADFKVQMIPFEETD--AREPDPI 202

  Fly   178 SAMLADRQRELNL----PRNRDDREQREKQEIRQDQRKELRQDLRQEQRQDQ------REDRRQD 232
            :|.|..:.|.|:|    .|:.|.|..:.:...:|..:..:|:..|.::...|      .:.:...
  Fly   203 TAQLIKKARSLDLQSQATRSTDFRHTKPQVARKQPIQVRIRKTKRSKRSAPQMIKFELADAKAMP 267

  Fly   233 QREDRR------------QNQREDRRQDQ---REERREDQREERGEDQREERR 270
            ||..::            :.||.:.:..|   ...|.||.....||...|.:|
  Fly   268 QRSGKQMVSEAVPTLLTMETQRNNTQAPQLTTTTPRVEDNDILTGEATAETKR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 7/42 (17%)
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.