DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr35B

DIOPT Version :10

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:71 Identity:23/71 - (32%)
Similarity:37/71 - (52%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GYQEQDTARAFY--SYGYRDENA--ARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFK 87
            |:.:...:.|.|  .||.:|:..  .:::..||.| |..|.|..:||||..:||.|.|:..:||:
  Fly    61 GHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFE 125

  Fly    88 AEASNQ 93
            |....:
  Fly   126 AHVHRE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 18/47 (38%)
Smc <107..>387 CDD:440809
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:459790 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.