DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and CG16800

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_609594.2 Gene:CG16800 / 34693 FlyBaseID:FBgn0032462 Length:282 Species:Drosophila melanogaster


Alignment Length:99 Identity:18/99 - (18%)
Similarity:41/99 - (41%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 LSAMLADRQRELNLPRNRDDREQREKQEIRQDQRKELRQDLRQEQRQDQREDRRQDQREDRRQNQ 241
            :||.|..:..|...|.....:||.|.|.:...:.:|..:...:|..::...:....:....::..
  Fly    30 ISAALLGQDFEDFQPYFAHKQEQEEDQLVAATKHEEHSEGGEEESGEEHHSEHFHKKGGKSKKGH 94

  Fly   242 REDRRQDQREERREDQREERGEDQREERREDRRE 275
            :.....::.|:...|:..::||...||..|.:.:
  Fly    95 KHGEHSEKGEKGHHDKEGKKGEHGEEEGHEKKHK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791
CG16800NP_609594.2 DUF4779 98..221 CDD:292628 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.