DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ec and Cpr23B

DIOPT Version :9

Sequence 1:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:116 Identity:39/116 - (33%)
Similarity:54/116 - (46%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AFYSYGYRDENAARA---EYS-SRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQA 96
            |.||:.|...:|:..   |:| :||| ..|||||.:|.||..:||.|.|:.|.||.|..:..|.|
  Fly   155 ASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVPYA 219

  Fly    97 ------PVDKGKAPLPVTDTEEVQQARLNHLNALRE------AREKALATS 135
                  ||.:...|.|....:|    |...::.:|.      |.|..|:.|
  Fly   220 LKAVVVPVAQVAQPTPFVARDE----RSKSVDVIRSSGAAAGASENVLSGS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:278791 21/47 (45%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.